Expand PubMLST Databases Downloads BIGSdb Contact Account

Neisseria PorA Variable Region 2

Neisseria Home | PorA Home | VR1 | VR2 | Query | Batch query

VariantPrevious nomenclaturePeptide sequenceMonoclonal antibody and its reactivity (key)GenbankPubMed
P1.1 familyMN14C2.3
1YVAVENGVAKKVA+X571791904526; 15200858
1-11aYVAVENGATKKVA+AF15936010979914; 15200858
1-21bYVAVENGVVKKVAND15200858
1-31cYVAVENGVAKKVTND15200858
1-4YVAVENGVTKKVAND
1-5YVAVENDVAKKVAND
1-6YVAVENGVDKKVAND
1-7YVAVENGVKKVAND
1-8YMAVENGVAKKVAND
1-9YVAVEKGVAKKVAND
1-10ENGVAKKVA (missing YVAV motif)ND
1-11YVAVENGVAKAKKVAND
1-12YVAVENSVAKKVAND
1-13YVAVENGGAKKVAND
1-14YVAVEDGVAKKVAND
1-15YVAVENGVAEKVAND
1-16YVAVGNGVDKKVAND
1-17YVAVENGEAKKVAND
1-18YVAEENGVAKKVAND
1-19YVAVENGVAKEVAND
1-20YVAMENGVAKKVAND
P1.2 familyMN16C13F4AF202
2HFVQQTPKSQPTLVP+-X571821904526; 15200858
2-12bHFVQQPPKSQPTLVP-+Z142888807211; 15200858
2-22cHFVQQTPQSQPTLVP+NDX774248057850; 15200858
2-32eHFVQQPPKSQLTLVP+ND15200858
2-42fHFVQQTPQSRPTLVPNDND15200858
2-52gHFVQQIPQSQPTLVPNDND15200858
2-62iHFVQQTPTLVP-NDAF16734710979914; 15200858
2-7HFVQQTSKSQPTLVPNDND15200858
2-8HFVQQTTKSQPTLVPNDND15200858
2-9HFVQQTPQSKPTLVPNDND15200858
2-10HFVQQAPQSQSTLVPNDND15200858
2-11HFVLQTPQSQPTLVPNDND15200858
2-12HFVQQIPKSQPTLVPNDND15200858
2-13YFVQQTPQSQPTLVP+NDAF23981015200858
2-1433HFVQQKLASKPTLVPNDND15200858
2-1533a (33-1)HFVQQKSTSKPTLVPNDND15200858
2-1633b (33-2)HFVQQKPTSKPTLVPNDND15200858
2-1733c (33-3)HFVQQQPTSEPTLVPNDND15200858
2-18HFVQQIPKSQPILVPNDND15200858
2-19HFVQQTSQSQPTLVPNDND15200858
2-20HFVQQTPIVQQTPKSQPTLVPNDND15200858
2-21HFVQQTHQSQPTLVPNDND
2-22HSVQQTPKSQPTLVPNDND
2-23HFVQQTPKSQPPLVPNDND
2-24HFVQQTPTHFVQQTPKSQPTLVPNDND
2-25HFVQQTPKSVPNDND
2-26HFVQQTPQRQPTLVPNDND
2-27HFVQQTPNSQPTLVPNDND
2-28PQSQPTLVP (missing HFVQQ motif)NDND
2-29HFVQQTPQSQTPQSQPTLVPNDND
2-30HLVQQTPQSQPTLVPNDND
2-31HFVKSQPTLVPNDND
2-32HFVQQTPKSQPTPKSQPTLVPNDND
2-33HFVQQASQSQPTLVPNDND
2-34HFVQQTPQSQPKSQPTLVPNDND
2-35HFVQQTPKSQPILVPNDND
2-36HFVQQTPQIQPTLVPNDND
2-37HFVQQKPTSNPTLVPNDND
2-38HFVQQTPKRQPTLVPNDND
2-39HFVQQTPQGQPTLVPNDND
2-40HFVQQISKSQSTLVPNDND
2-41HFVQQTPQSQPTPQSQPTLVPNDND
2-42HFVQQIPQSKPTLVPNDND
2-43HFVQQTPKSRPTLVPNDND
2-44HFVQQTPQSHTLVPNDND
2-45HFYTPAHFVKSQLTLVPNDND
2-46HFVQQTPESQPTLVPNDND
2-47HFVQQTPKSQPNLVPNDND
2-48HFVQQIPTSQPTLVPAQNSKSAYTPAHFVQQIPTSQPTLVPNDND
2-49HFVQQTPKSQPTQSQPTLVPNDND
2-50HFVQQTSQSRPTLVPNDND
2-51HFVQQISKSQPTLVPNDND
2-52HFVQKTPQSQPTLVPNDND
2-53HFVQQTPKSQSTLVPNDND
2-54HFVRQTPKSQPTLVPNDND
2-55HFVQQTPESQPNLVPNDND
2-56HFVQQTPQNQPTLVPNDND
2-57HFVQQAPQSQPTLVPNDND
2-58HFVQQTLQSQPTLVPNDND
2-59HFVQQTP (missing TLVP motif)NDND
2-60HFVQQTPKSWPTLVPNDND
2-61HFVQRTPQSQPTLVPNDND
2-62HFVQQTPQSQPILVPNDND
2-63HFVQQTPRSQPTLVPNDND
2-64HFVPQTPKSQPTLVPNDND
2-65HFVQQPPKSQPTQPTQPTLVPNDND
2-66HFVQQTPPSQPTLVPNDND
2-67HFVQQTLKSQPTLVPNDND
2-68HFVQQTPQSQP (missing TLVP motif)NDND
2-69HFVQQTSTSQPNLVPNDND
2-70HFVQQIPQSQP (missing TLVP motif)NDND
2-71HFVQQAPKSQPTLVPNDND
2-72HFVKQKPTSKPTLVPNDND
2-73HFVQQTPSIQPTLVPNDND
2-74HFVQQTPPIQPTLVPNDND
2-75HFVQQASKSQPTLVPNDND
2-76HFVQQTLQSRPTLVPNDND
2-77HFVQQPTLVPNDND
2-78HFVQQTPQIHPTLVPNDND
2-79HFVQQTSESQPTLVPNDND
2-80HFVQQTLKSQTTLVPNDND
2-81HFVQQTPQSQLTLVPNDND
2-82HFVQQSPKSQPTLVPNDND
2-83HFVQQILQSRQHTLVPNDND
2-84HFVLQTPKSQPTLVPNDND
2-85HFVQQTPQNQLTLVPNDND
2-86HFVQQAPKSQPTVPNDND
2-87QTLQSQPTLVP (missing HFVQ motif)NDND
2-88HFVQQTLQRQPTLVPNDND
2-89HFVQQTPQSQSTLVPNDND
2-90HFVQQTPQTQPTLVPNDND
2-91HFVRQTPPSQPTLVPNDND
2-92HFVQQTLPRQPTLVPNDND
2-93RFVQQTPKSQPTLVPNDND
2-94PFVQQTPKSQPTLVPNDND
2-95HFVQQIPQNQPTLVPNDND
2-96HFVQQTVQQTPKSRPTLVPNDND
P1.3 family5G8B2F9
3TLANGANNTIIRVP+X774238057850; 15200858
3-13aTVANGANNTIIRVPNDAF11245310417147; 15200858
3-23bTLANGANDTIIRVPND15200858
3-3TLANGADNTIIRVPND15200858
3-4TPANGANNTIIRVPND15200858
3-5TLAKGANNTIIRVPND15200858
3-6TLANGATNTIIRVPND
3-7TLATLANGANNTIIRVPND
3-8TLANNTIIRVPND
3-9TLANGANNTP (Missing IIRVP motif)ND
3-10TLADGANSTIIRVPND
3-11TLANGLANGANNTIIRVPND
3-12TLANGANGANNTIIRVPND
3-13TLANGANANNTIIRVPND
3-14TLANGDNNTSIRVPND
3-15TLANGANTNGANNTIIRVPND
3-16TLANGAKNTIIRVPND
3-17TLASGANNTIIRVPND
3-18TLANGADDTIIRVPND
3-19TLANGANKTIIRVPND
3-20TLANSANNTIIRVPND
3-21NGANGANTNNTIIRVPND
3-22TLANGANTIIRVPND
3-23TLANGANNTNIRVPND
3-24TLANDANNTIIRVPND
3-25NGANDTIIRVP (missing TLA motif)ND
3-26TLANGANNNTIIRVPND
3-27TLANDANTIIRVPND
3-28TLAKGANNTIIPKGANNTIIRVPND
3-29TLANGANNNGANNTIIRVPND
P1.4 familyMN20B9.34
4HVVVNNKVATHVP+1452652; 15200858
4-14aHVVVNNNVATHVP-U929489801347; 15200858
4-24bHVVVNNKVATHVPAKVATHVP-15200858
4-34cHVVVNNKVTTHVPND15200858
4-4HVVVNNKVATPHVPND
4-5HVVVNNKV (missing THVP motif)ND
4-6HVVVNNRVATHVPND
4-7HVVVKVATHVPND
4-8HVVVNNQVATHVPND
4-9VNNKVATHVPND
4-10HVVNNKVATHVPND
4-11HVVVNNKVAPHVPND
4-12HVHVVVNNKVATHVPND
4-13HVVVNNKVA (missing THVP motif)ND
4-14HFVVNNKVATHVPND
4-15HVVVNNEVATHVPND
4-16HVVVNNVVVNNKVATHVPND
4-17SVVVNNKVATHVPND
4-18HVVVNNKVAT (missing HVP motif)ND
4-19HVVVNNKVATYVPND
4-20HVVVNNNVATRVPND
4-21HVVVNKKVATHVPAVND
4-22HVVVNKKVATHVPND
4-23HVVVNNMVATHVPND
4-24HVVVNNTVATHVPND
4-25YVVVNNKVATHVPND
4-26HVVVNNNVTTHVPND
4-27HVVVNNKVATHV (missing final P)ND
4-28HVVVVNNKVATHVPND
4-29DVVVNNKVATHVPND
4-30HVVVNNK (missing THVP motif)ND
4-31HVVVNNKVATH (missing VP motif)ND
4-32HVVVNHKVATHVPND
4-33HVVVNNNVVVNNNVATHVPND
4-34HVVVNNKVVTHVPND
4-35PVVENNKVATHVPND
4-36HVVVNN (missing THVP motif)ND
4-37HVVVNDKVATHVPND
4-38HVVVSNKVATHVPND
4-39HVVVNKKVATQKVATHVPND
4-40HVVMNNKVATHVPND
4-41HGVVNNKVTTHVPND
4-42HVVENNNVATHVPND
4-43HVVNNEVATHVPND
P1.9 familyMN5A10F
9YVDEQSKYHA+X571811904526; 15200858
9-19aYVDSKYHA-AF14864315200858
9-2YVGEQSKYHAND15200858
9-3YVDEQSKDHAND15200858
9-4YVDKQSKYHAND15200858
9-5YVDEQSEYHAND15200858
9-6YVDEQSQYHAND
9-7YVDEQRKYHAND
9-8YVDEPSKYHAND
9-9YVDEQSKYHTND
9-10EQSKYHA (missing YVD motif)ND
9-11YVYEQSKYHAND
9-12YVDEQSKYPAND
9-13YVDEQNKYHAND
9-14YVDEQSEYPAND
9-15YVDEQSKDEQSKYHAND
9-16YVDEKSKYHAND
9-17YVDEPSEYHAND
9-18YVDEQSNYHAND
9-19YVDEQSKCHAND
9-20YVDEQSKYDAND
9-21YVDEQGNAHAND
9-22YVDEQS (missing KYHA motif)ND
9-23YVDESNQYHAND
9-24YVDENKKFHTND
9-25YVDEQSKYAND
9-26YMDEQSNYHAND
9-27YVDENGNAHAND
9-28YVDEKGNAHAND
9-29YMDEQSKYHAND
9-30YVDEQSEQSKYHAND
P1.10 familyMN20F4.17
10HFVQNKQNQRPTLVP+X774228057850; 15200858
10-110aHFVQNKQNQPPTLVP(+)8581171; 8807211; 15200858
10-210bHFVQDKKGQPPTLVPND8581171; 8807211; 15200858
10-310cHFVQNKQNQQPTLVP(+)8581171; 8807211; 15200858
10-410dHFVQNKQNKQNQPPTLVPND8581171; 8807211; 15200858
10-510eHFVQNKQSQRPTLVP(+)X774288057850; 15200858
10-610fHFVQNKQNQQNQQNQPPTLVPND8581171; 8807211; 15200858
10-710gHFVQNKQNKPPTLVP-8581171; 8807211; 15200858
10-810kHFVQNKQNQQNQPPTLVPND15200858
10-910lHFVQNKQNKQNQLPTLVPND15200858
10-1010mHFVQNKQNKQNKQNQPPTLVPND15200858
10-1110nHFVQNKQNQRSTLVP-AF18227815200858
10-1210oHFVQNKQNQLPTLVP-15200858
10-1310pHFVQNKQNKKNQPPTLVPND15200858
10-1410qHFVQNKQHQPPTLVPND15200858
10-1510rHFVQNKQNQPSTLVPND15200858
10-1610sHFVQNKQNQWSTLVPND15200858
10-1710tHFVQNKQNQTPTLVPND15200858
10-1810uHFVQNKQSQPPTLVPND15200858
10-1910wHFVQNKQNKQKQPPTLVP-AF15361410979914; 15200858
10-2010vHFVQNKQNQWLTLVP-AF16234615200858
10-2110xHFVPDKKGQPPTLVPNDAF17294510979914; 15200858
10-2210yHFVQNKQNKQNQQNQPPTLVPND15200858
10-23HFVQNKQNQWPTLVPND15200858
10-24HFVKNKQNQRPTLVP-AF25500010979914; 15200858
10-25HFVQDKKGQP (missing PTLVP motif)ND15200858
10-26HFVQNKQNKPNQPPTLVPND
10-27HFVRNKQNQRPTLVPND
10-28HFVQNQNKQNQPPTLVPND
10-29HFVQNKQNQSPTLVPND
10-30HFVQNKQNQRPTLV (missing P from end motif)ND
10-31HFVPNKQNQRPTLVPND
10-32HFVQNKQDQRPTLVPND
10-33HFVQNKQNKQPTLVPND
10-34YFVQNKQNKQNQPPTLVPND
10-35HFVQNKQNQQNQQPTLVPND
10-36HFVQDKKGQLPTLVPND
10-37HFVQNKQNQPLTLVPND
10-38HFVQDKQDQLPTLVPND
10-39HFVQNKQNPPPTLVPND
10-40HFVQNKQKQPPTLVPND
10-41HFVQNKQNQRLTLVPND
10-42HFVQNKQNQQNQPSTLVPND
10-43HFVQNKQNKLPTLVPND
10-44HFVQDKKGQSPTLVPND
10-45HFVQNKQNQRP (missing TLVP end motif)ND
10-46HFVQNKQNKQNKPPTLVPND
10-47HFVQNKQSQQPTLVPND
10-48HFVQNKPTLVPND
10-49HFVQNKQDQPPTLVPND
10-50HFVRNKQNQQSTLVPND
10-51HFVQNKQNVQNKQNQPPTLVPND
10-52HFVQNKQNKQNKQNKQNQPPTLVPND
10-53HFVQNKQNQQNQQNQSPTLVPND
10-54HFVQNKQSQLPTLVPND
10-55HFVQNQQNQPPTLVPND
10-56HFVRDKKGQRPTLVPND
10-57HFVQNKQNKQNKQNQLPTLVPND
10-58HFVQDKKDQPPTLVPND
10-59HFVQNKQNEPPTLVPND
10-60HFVQNKQNKQNQRPTLVPND
10-61HFVQNKQNQSSTLVPND
10-62HFVQNKQNQ (missing *PTLVP motif)ND
10-63HYKQNQPPTLVPND
10-64HFVQNKQKQRPTLVPND
10-65HFVKNKQNQQPTLVPND
10-66HFVQNKQNKQNQSPTLVPND
10-67HFVQNKQNQRTTLVPND
10-68HFVQNKQNQPPLVPND
10-69HFVQNKQNPRPTLVPND
10-70HFVENKQNQPPTLVPND
10-71HFVQNQQNQRPTLVPND
10-72HFVQNKQNQVPND
10-73HFVQNKQNQQNQQNQLPTLVPND
10-74HFVQNKQTQPPTLVPND
10-75HFVRNKQNQLPTLVPND
10-76RFVQNKQNKQNQPPTLVPND
10-77HFVQNKQNKQNKQNKPPTLVPND
10-78HFVQNQNKPNQPPTLVPND
10-79HFVQNKQNQQSTLVPND
10-80HFVQNKQQNQPPTLVPND
10-81HFVQNKQNKQNQQNQLPTLVPND
10-82HFVQDKKGQPLTLVPND
10-83HFVQDKKGQTPTLVPND
10-84YFVQNKQNQRPTLVPND
10-85HFVRNKQNQPPTLVPND
10-86HFVQNRQNQPPTLVPND
10-87KKNQPPTLVP (Missing HFVQNKQN motif)ND
10-88HFVQNKQNPPTTLVPND
10-89HFVQNKQNKWPTLVPND
10-90HFVQDKEGQPPTLVPND
10-91HFVKNKQNQPPTLVPND
10-92HFVQDKNGQPPTLVPND
10-93HFVQNKQNPSPTLVPND
10-94HFVQNNQNQPSTRVPND
10-95HFVLDKKGQRPTLVPND
10-96HFVQNKQPPTLVPND
10-97HFVQNEQNQQPTLVPND
10-98HFVQNKQNKQNQQNQQNQPPTLVPND
10-99HFVQNKQNKQNQQNKQNKQNQPPTLVPND
10-100DFVQNKQNQPPTLVPND
10-101HFVRNEQNQPPTLVPND
10-102HCVQNKQNQSPTLVPND
10-103HFVQNKQNWLSTLVPND
10-104HFVLNKQNQPPTLVPND
10-105HFVQNKQNKQNQQPTLVPND
10-106HFVQDKKGQQPTLVPND
10-107HFVQHRPTLVPND
10-108HFVQNEQNQPPTLVPND
10-109HFVQNKQNESPTLVPND
10-110PFVQNKQNQPPTLVPND
10-111HFVQDKKGQLSTLVPND
10-112HFVQDKNSQSPTLVPND
P1.13 familyMN25H10.75202,G12
13YWTTVNTGSATTTTTFVP+-7664178; 15200858
13-113aYWTTVNTGSATTTTFVP-+X774278057850; 15200858
13-213bYWTTVNTGSATTTFVP+ND7664178; 15200858
13-313cYWTTVNTGSATITTFVPNDND8807211; 15200858
13-413dYYTTVTQGSATTTTFVP-ND8807211; 15200858
13-513eYWTTVNTGSATTTTTTTTTFVP--Z480337664178; 15200858
13-613fYWTTVNTGSATTTTTTTTFVPNDNDU939079522450; 15200858
13-713gYWTTVNTGSATTTTTTFVP--U939049522450; 15200858
13-813hYWITVNTGSATTTTFVP-+7664178; 15200858
13-913iYWTTVNTGSATTFVP+ND15200858
13-1013jYWTTVNTGSVTTTTFVPNDND15200858
13-1113kYWTTVNTGSAATTTTFVPNDND15200858
13-12YWTAVNAGSATTTFVPNDND15200858
13-13YWTTVNNGNATTTTFVPNDND
13-14YWTTVNTSSATTTTTFVPNDND
13-15YWTTVNTGSATTTTTTTFVPNDND
13-16VNTGSATTTFVP (missing YWTT motif)NDND
13-17YWTTVNTGNATTTTFVPNDND
13-18YWTTVNTSSATTTTFVPNDND
13-19YWTTVNTGSATTPFVPNDND
13-20YYTTVTKGNATTTTFVPNDND
13-21YWTTVNTGSAT (missing TTTTFVP motif)NDND
13-22YWTTVNNGNATTTFVPNDND
13-23YWTTVNAGSATTTTTFVPNDND
13-24YRTTVNTGSATTTFVPNDND
13-25YWTTVNTGSATTATTFVPNDND
13-26YYTTVTQGGATTTTFVPNDND
13-27YWTTVNNGNATTTTTTTFVPNDND
13-28YWPTVNTGSATTTFVPNDND
13-29YYTTVTNGNATTTTFVPNDND
13-30YYTTVTEGSATTTTFVPNDND
13-31YWTTVNTGSATTTTTTTTTTTTTTFVPNDND
13-32YWTTVNTGSATTTTTTTTTTFVPNDND
13-33VNTGSATTFVP (missing YWTT motif)NDND
13-34YWTTVNSGSATTTTFVPNDND
13-35YWTTVNTGSFVPNDND
13-36YYTTGSATTTTFVPNDND
13-37YWTTVNNGNATTTTTTFVPNDND
13-38YWTTVNTGSATTTTTTTTTTTTTFVPNDND
13-39YWTTVNNGNATTTTTFVPNDND
13-40YWTTVNTDSATTTTTFVPNDND
13-41YWTTVNTGSATTPTTFVPNDND
13-42YWTTVNTGSATTTSFVPNDND
13-43YWTTVNTGSATT (missing TTTFVP motif)NDND
13-44YWTTVNTVSATTTTTTTFVPNDND
13-45YWTTTTFVPNDND
13-46YWTTVNIGSATTTFVPNDND
13-47YYYTIVTQGSATTTTFVPNDND
13-48YYYTTATSSSTTFVPNDND
13-49YYTTVTQSSATTTTFVPNDND
13-50SYYTTVTQDSATTTTFVP (extra N terminus residue)NDND
13-51YWTTVDTGSATTTFVPNDND
13-52YYTTVTKGNATATTFVPNDND
13-53YWTTLNTGSATTTTFVPNDND
13-54YWTTVYTGSATTTTFVPNDND
13-55YWTTVNTAGSATTTTFVPNDND
13-56YWTIVNTGSATTTTFVPNDND
13-57YRTTVNTGSATTTTTFVPNDND
13-58YWTIVNTGSATTTTTTFVPNDND
13-59YWTTVNAGSATTTFVPNDND
13-60YWTTVNTGNTGSATTTTFVPNDND
13-61YWTTVNIGSATTTTFVPNDND
13-62YWTTVNTGSAATTTFVPNDND
13-63YYTTVTQGSATATTFVPNDND
13-64YWTTVNTNSAPTFVPNDND
13-65YWTTVHTGSATTTFVPNDND
13-66YWTTVHTGSATTTTFVPNDND
13-67YWTTVNIGSATTTTTTFVPNDND
13-68YWTTVHTGSATTTTTFVPNDND
13-69YYTTVTKGNATTTTTTFVPNDND
13-70YWTTVNNGNATTFVPNDND
13-71YWTTVKTGSATTTFVPNDND
13-72YYTTVTEGNATTTTFVPNDND
13-73YWTTVNNGNATTTTTTTTFVPNDND
13-74YWTTVNAGSATTTTFVPNDND
13-75YWTTVNNGNATTNFVPNDND
13-76YWTTVNTSSATTTFVPNDND
13-77YWTTVVNNGAATTFVPNDND
13-78GSATTTTFVP (missing YWTTVNT motif)NDND
P1.14 familyMN21G3.17
14YVDEKKMVHA+1452652; 15200858
14-114aYVDEKKKMVHA-AF0515419801347; 15200858
14-214bYVDEKKKVHA-9632588; 15200858
14-314cYVDEKNMVHA+9632588; 15200858
14-414dYVDENKMVHANDAJ01272510391880; 15200858
14-514eYVDKEQVSHAND15200858
14-614fYVDEKQVSHA-15200858
14-714gYVDETKMVHAND15200858
14-8YVDEKRMVHAND15200858
14-9YVDAKKMVHAND15200858
14-10YVDEKGMVHAND
14-11YVDEKRVSHND
14-12YVNEKKMVHAND
14-13YVDEEQVSHAND
14-14YVDERKMVHAND
14-15YVDEKEMVHAND
14-16YVEEKKMVHAND
14-17YVDEKKVSHAND
14-18YVDENQVSHAND
14-19YVDEKQMVHAND
14-20YVDEKKIVHAND
14-21YVDENNMVHAND
14-22YVDEKKMVYAND
14-23YVGEKKMVHAND
14-24YVYEKKMVHAND
14-25YVDERQVSHAND
14-26YVDEKKVVHAND
14-27YVDEKKTVHAND
14-28YVDEKMVHAND
14-29YVDEKKRVHAND
14-30YVDDKKMVHAND
14-31YVDEEKMVHAND
14-32YVDEQKMVHAND
14-33YVDEQQVSHAND
14-34YVDEKKMVQAND
14-35DVDEKKRVHAND
14-36YVYEKQVSHAND
14-37YVHEKKMVHAND
14-38YVDEKKRVYAND
14-39YVDEKMMVHAND
14-40YVDEKTMVHAND
14-41YVDEKKNVHAND
14-42YMDENNMVHAND
14-43YVGEEQVSHAND
14-44YVDEKRQVHAND
14-45YVGEMQVSHAND
14-46YVDEEQASHAND
14-47YVDEMKMVHAND
14-48YVDEKPVSHAND
14-49YMDEKKMVHAND
14-50YMVHAND
14-51YVDEKKMVDAND
14-52YVAEKKMVHAND
14-53YDEKKMVHAND
14-54VDEKKMVHA (missing initial Y residue)ND
14-55YVDEMKVSHAND
14-56YVDEGQVSHAND
14-57YVEKMVHAND
14-58YVDEKDEKQVSHAND
14-59YMDEKTMVHAND
14-60YVNEEQVSHAND
14-61YVDETQVSHAND
P1.15 familyMN3C5C
15HYTRQNNADVFVP+X571771904526; 15200858
15-115aHYTRQNNTDVFVP+Z142641693651; 15200858
15-215cHYTRQNNNNTDVFVPND15200858
15-315dHYTRPNNTDVFVPNDAJ01273610391880; 15200858
15-415eHYNTRQNNADVFVPND15200858
15-515fHYTRQNSADVFVPND15200858
15-615gHYTRQNYADVFVPND15200858
15-715hHYTRQNNANVFVP+AF17386210979914; 15200858
15-8HYTRQNNAGVFVP+AF23776711474010; 15200858
15-9HYTRQNNTRQNNADVFVP+AF24823911474010; 15200858
15-10HYTGQNNADVFVP+AF24824011474010; 15200858
15-1115bHYTRQNNIDVFVPNDZ142608807211; 15200858
15-12HYNTRQNNIDVFVPND15200858
15-13HYTRQNNQNNIDVFVPND15200858
15-14HYTNTRQNNIDVFVPND15200858
15-15HYTRQSNTDVFVPND15200858
15-16HYTRQNNADFVPND15200858
15-17HYTRQNNAYVFVPND
15-18HYTRQNNDTRQNNADVFVPND
15-19HTRQNNIDVFVPND
15-20HYTRQNNAAVFVPND
15-21HYTRQNDADVFVPND
15-22HYTRQNNYTRQNNIDVFVPND
15-23HYTSQNNADVFVPND
15-24HYTRQNDTDVFVPND
15-25HYTKQNNTDVFVPND
15-26HYTGQNYIDVFVPND
15-27HYTRKNNADVFVPND
15-28HTRQNNADVFVPND
15-29HYTRQNNIDDTRQNNIDVFVPND
15-30HYTRQNNTD (missing VFVP motif)ND
15-31HYTRQNKADVFVPND
15-32HYTRQNNNIDVFVPND
15-33HYNADVFVP (missing HYTR motif)ND
15-34HYTKQNNADVFVPND
15-35HYTRQNN (missing ADVFVP motif)ND
15-36HYTRQNNINIDVFVPND
15-37HYTGQNNIDVFVPND
15-38QQNNTDVFVP (missing HYTR motif)ND
15-39HYTRQNNADV (missing FVP motif)ND
15-40HYTRQNNVDVFVPND
15-41HYTRQDNADVFVPND
15-42HYTRQNNDVFVPND
15-43HYTRQNYIDVFVPND
15-44NYTKQNNTDVFVPND
15-45NYTKQNNTGVFVPND
15-46HYTKQNDTDVFVPND
15-47HYTSRQNNADVFVPND
15-48HYYTRQNNADVFVPND
15-49HYTRQNNNNIDVFVPND
15-50HYTRQNDIDVFVPND
15-51HYTRQNNADAFVPND
15-52HYTMQNNADVFVPND
15-53HYTRQNNLDVFVPND
15-54HYNYTRQNNADVFVPND
15-55HYTRQTNADVFVPND
15-56HYTKQNTKQNNTDVFVPND
15-57HYTKQKNADVFVPND
15-58HYTSQNNDTSQNNADVFVPND
15-59HYTRQNNFVPND
15-60HYTRQSNIDVFVPND
15-61HYTSQNN (missing ADVFVP motif)ND
15-62HYIRQNNADVFVPND
15-63HYTRQYTRQNNADVFVPND
15-64HYTKQNNIDVFVPND
15-65HYTSQNNVDVFVPND
15-66HYTKQSNADVFVPND
15-67HYTRQNNADENNADVFVPND
15-68HYTSQNKADVFVPND
15-69HYTGQNNDYVFVPND
15-70HYTRQDNTDVFVPND
15-71HYTRQNTTDVFVPND
15-72HYTSQNNADVCVPND
15-73HYTNTRQNNADVFVPND
15-74HYTRQNYTDVFVPND
15-75HYTKQNNKQNNTDVFVPND
P1.16 familyMN5C11G
16YYTKDTNNNLTLVP+X571781904526; 15200858
16-116wYYTKGKNNALTLVP-15200858
16-216bYYTKNTNNNLTLVP+X664771560777; 15200858
16-316cYYTKDKNDNLTLVP-U939059522450; 15200858
16-416dYYTKDKNDKLTLVPNDU939089522450; 15200858
16-516eYYTKDTNNNNNLTLVPNDU939069522450; 15200858
16-616fYYTKHTNNNLTLVPND15200858
16-716gYYTKDTNTKDTNNNLTLVP-15200858
16-816hYYTKDKNNALTLVP-10979914; 15200858
16-916iYYTKDTNDLTLVPND15200858
16-1016jYYTNNNLTLVPND15200858
16-1116kYYTTDTNNNLTLVPND15200858
16-1216lYYTKDTNDNLTLVPND15200858
16-1316mYYTEDTNNNLTLVPND15200858
16-1416nYYTKDTNTNLTLVPND15200858
16-1516pYYNTKDTNNNLTLVPND15200858
16-1616qYYTKDTNNNPTLVPND15200858
16-1716rYYTKDTNNTNNNLTLVP-AF16383110979914; 15200858
16-1816sYYTKDTNTNNNLTLVP-AF14374415200858
16-1916tYYTKDTNNNLTHTKDTNNNLTLVP-AF14447810979914; 15200858
16-2016uKDTNNNLTLVP (missing YYT motif)+AF14608310979914; 15200858
16-2116vYYTKDTKNNLTLVP-AF15935810979914; 15200858
16-22YYTKDTNNILTLVPND15200858
16-23YYTKDNKNDNLTLVP-AF25500110979914; 15200858
16-24YYTKVENDNLTLVPND15200858
16-25YYTKDTNNNLNLTLVPND15200858
16-26YYTNTNNNLTLVPND15200858
16-27YYTKDTNNNLTLVSND15200858
16-28YYTKVKNDNLTLVPND
16-29YYTKGTNNDLTLVPNDAF489496
16-30YYTKDKNDNRTLVPND
16-31YYTKHTNNNPTLVPND
16-32YYTKVTNNNLTLVPND
16-33YYTNTKDTNNNLTLVPND
16-34YYTKDTNNNLKDTNNNLTLVPND
16-35YYTKHANNNLTLVPND
16-36YYTKGTNNNPTLVPND
16-37YYTKVTDNNLTLVPND
16-38YYTKDTNNNLPLVPND
16-39YYTKDTTNNNLTLVPND
16-40YYNTKDTKNNLTLVPND
16-41YYTKDTNNKLTLVPND
16-42YYTKDTNYTKDTNNNLTLVPND
16-43YYTKDTNNNLTNNNLTLVPND
16-44YYTNTNDNLTLVPND
16-45YYTNYTKDTNNNLTLVPND
16-46YYTKDTKDTNNNLTLVPND
16-47YYTKDTSNNLTLVP(+)AF28795611179386
16-48YYTKDRNNNLTLVPND
16-49YYTKDKNDDLTLVPND
16-50YYTKDTNNNL (missing TLVP motif)ND
16-51YYKDTNNNLTLVPND
16-52YYTKDKNDALTLVPND
16-53YTNTNNNLTLVP (missing first Y)ND
16-54YYTKVINNNRTLVPND
16-55YYTKDTNNNLNNLTLVPND
16-56YYTKDTNNNLTHNLTLVPND
16-57YYTKDKDTNNNLTLVPND
16-58YYTKDTDNNLTLVPND
16-59YYTKGTNNNLTLVPND
16-60YYTKDKNDNLTPVPND
16-61YYTKKDKNDNLTLVPND
16-62YYTKDINNNLTLVPND
16-63YYTKNTNNKNTNNNLTLVPND
16-64YYTKDTNNPLVPND
16-65YYTKYTNNNLTLVPND
16-66YTKDTNNNLTLVP (missing first Y)ND
16-67YYTKDKTDNLTLVPND
16-68YYTNTNNNL (missing TLVP motif)ND
16-69YYTKDTNNNTKDTNNNLTLVPND
16-70YYPKDTNNNLTLVPND
16-71YYTKTLVPND
16-72YYTKDTNNNLTLVNLTLVPND
16-73YYNTKDTTNNLTLVPND
16-74YYTYYTQDTNNNLTLVPND
16-75YYTKDTNNDLTLVPND
16-76YYTKDTNNVPND
16-77YYTDTNNNLTLVPNDDQ411822
16-78YYTKDKNLVPND
16-79YYTKYKNDNLTLVPND
16-80YYTKDKNKALTLVPND
16-81YYTKDENDKLTLVPND
16-82YYTKDTNINLTLVPND
16-83YYTKDTNNLTLVPND
16-84YYTNNLTLVPND
16-85YYTNVTNNNLTLVPND
16-86KDTNNNLALVP (missing YYT motif)ND
16-87YYTNYTKDKNDNLTLVPND
16-88YYTKDTNNHLTLVPND
16-89YYTKDTNKNLTLVPND
16-90YYIKGTNNDFTLVPND
16-91YYTKDKNNLTLVPND
16-92YYNNLTLVPND
16-93TKDKNDNLTLVP (missing YY motif)ND
16-94YYTNTKDKNDNLTLVPND
16-95YYTKDKNDHLTLVPND
16-96YYTKDTNNNLTLVLTLVPND
16-97YYTKVTINNLTLVPND
16-98YYTKDANNNLTLVPND
16-99YYTKDTNNNP (missing TLVP motif)ND
16-100YYTKDTNNSLTLVPND
16-101YYTKGTNNDFTLVPND
16-102YYTKDTNNNLTLNNLTLVPND
16-103YYTTKDTNNNLTLVPND
16-104YYTKDKNDQLTLVPND
16-105YYTKGTNINLTLVPND
16-106YYTNTNTNNNLTLVPND
16-107YYTKDTNNTKDTNNNLTLVPND
16-108YYTQDKNNALTLVPND
16-109YTKDTNNKLTLVPND
16-110YYTKDTKDTKDTNNNLTLVPND
16-111YYTKDNNNLTLVPND
16-112YYTKDTLVPND
16-113YYTKDTTLVPND
16-114YYTKDKNGALTLVPND
16-115YYTKGTNDNPTLVPND
16-116YYTKDTNDTNNNLTLVPND
16-117YYTKDTNNN (missing LTLVP motif)ND
16-118YYTKGKNDNLTLVPND
16-119YYIKDKNNALTLVPND
16-120YYTNTNNTNNNLTLVPND
16-121YYTNDTNNNLTLVPND
16-122YYTKNTNINLTLVPND
16-123YYTKDTNNITLVPND
16-124YYTNKDKNNALTLVPND
16-125YYTKDKNYALTLVPND
16-126YYTKDTNENLTLVPND
16-127YYTKGTNNNPTLFPND
16-128YYTNTNNNFTLVPND
16-129YYTQDTNNNLTLVPND
16-130YYTKDTNIVPND
16-131YYTKDTINNLTLVPND
16-132YYTKAKNDNLTLVPND
16-133YYANNLTLVPND
16-134YYTKDTNNTLTLVPND
16-135YYTKGKNDKLTLVPND
16-136YYTSTNNNLTLVPND
16-137YYNNNLTLVPND
16-138YYNNNL (missing LTLVP motif)ND
16-139YYTKETNNNLTLVPND
16-140YYTKDNLTLVPND
16-141YYTNTNNNPTLVPND
16-142YYTKNTNDNLTLVPND
16-143YNNLTLVP (missing first Y)ND
16-144YYTNNNLPLVPND
16-145YYTNKDTNNNPTLVPND
16-146YYTKVANNNLTLVPND
16-147YYTKVINNNLTLVPND
16-148YYPNTNNNLTLVPND
16-149YYTKDTNYNLTLVPND
16-150YYTKDKNN (missing LTLVP motif)ND
16-151YYTKDTNNTLVPND
16-152YYTKDTNNYLTLVPND
16-153YYIKDKNNAPTLVPND
16-154YYTNTTNNNLTLVPND
16-155YYTKDRNDALTLVPND
16-156PYTKNTNNNLTLVPND
16-157YTKDKNNALTLVP (missing first Y)ND
16-158YYTKDTSNNLALVPND
16-159YYTKGTKGTNNNPTLVPND
16-160YYTKDTNNVLTLVPND
16-161YYTKDKNDYLTLVPND
16-162YYTKDKNDNHLTLVPND
16-163YYTKDKNNAFTLVPND
16-164YYTKNKNDNLTLVPND
16-165YYTKNNLTLVPND
16-166YYTMDTNNNLTLVPND
16-167YYTKTNNNLTLVPND
16-168YYYKDKNDNLTLVPND
16-169YYTENNNLTLVPND
16-170YYTKVINNNLTLVTKVINNNLTLVPND
16-171YYTKDTNDDLTLVPND
16-172YYIKVKNNALTLVPND
16-173YYTYTKDKNDALTLVPND
P1.23 family
23HWNTVYNTNGTTTTFVPX774328057850; 15200858
23-123aHWNTVYNTNGTTTTTTTFVPAF14355810979914; 15200858
23-2HWNTVYNTNGTTTTTFVP15200858
23-3HWNTVYNTNGTTTTTTFVP
23-4HWTTVYNTNGTTTFVP
23-5HWTTVYNTNGTTATFVP
23-6HWNTVYNTNGTTTFVP
23-7HWNTVYNTNGTTTTTTTTFVP
23-8HWTTVYNTNGTTTTTFVP
23-9HWNTVYNTNGTTTTTTTTTFVP
23-10HRNTVYNTNGTTTTTTTFVP
23-11HWNTVYNTNGTATTFVP
23-12HWNTVYNTNGTTTVP
23-13HWTTVYNTNGTTTTFVP
23-14HWNTVYDTNGTTTTTTFVP
23-15HRNTVYNTNGTTTTTTTTFVP
23-16HWNTVYNTNGTTTTTVP
23-17HWNTVYDTNGTTTTFVP
23-18HWNTVYNINGTTTFVP
23-19HWNTVYNTNGTTTTTTTTTTTFVP
23-20HWNTVYNTNGTTTTTTTTTTTTFVP
23-21HWNTVYNTNGTTTTTTTTTTTTTFVP
23-22HWNTVYNINGTTTTFVP
23-23HWNTVYNTNDTTTTFVP
23-24HWNTVYNTNGTTFVP
23-25HWNTVYNTNGTTTTTTTTTTTTTTFVP
23-26HWNTVYNTNGT (missing TFVP motif)
23-27HWNTVYNINGTTTTTTTTTFVP
23-28HWNTVYNTNGTTTTTT (missing FVP motif)
23-29HWNTVYNTNATTTTFVP
23-30HWNAVYNTNGTTTTFVP
23-31HGNTVYNTNGTTTTFVP
23-32HWNTVYNTNVTTTTFVP
P1.25 family
25TYTVDSSGVVTPVPX571831904526; 15200858
25-125aTYTVDSSGVFTPVP15200858
25-225bTYTEGSSGVFTPVP15200858
25-325cTYTVDSSGVVTPLP15200858
25-425dTYTVGSRDVVTPVPAF16234515200858
25-525eTYTVDSSNVVTPVPAF15783415200858
25-625fTYTVDSGVVTPVPAF14658810979914; 15200858
25-725gYTVDSSGVVTPVP15200858
25-8TYTVDSSGVP15200858
25-9TYTVDNSSVVTPVP15200858
25-10TYTVDSSRVVTPVP
25-11TYTVDSSDVVTPVP
25-12TYTVDSSSVVTVPV
25-13TYTVDSMDSSGVVTPVP
25-14TYTVNSSSVVTPVP
25-15TYTVDSSSVVTPVP
25-16SSGVFTPVP (missing TYTVDS motif)
25-17TYVDSSGVVTPVP
25-18TYTVDSSGGVTPVP
25-19TYTVDSRGVVTPVP
25-20TYTVGSSGGVTPVP
25-21TYTVDRSDVVTPVP
25-22TYTVNSSSSVVTPVP
25-23TYTVGGSGVVTPVP
25-24TYTVDSSSGVVTPVP
25-25TYTVDSSAVVTPVP
25-26TYTVDSSGVVP
25-27TYTVDNSSGVFTPVP
25-28TYTVTVDSSGVVTPVP
25-29TYTVDSSDVFTPVP
25-30TYTMDSSGVFTPVP
25-31TYTVDSSGVTPVP
25-32TYTVDSSSSVVTPVP
25-33DSSGVVTPVP (missing TYTV motif)
25-34TYTVDSRDVVTPVP
25-35TYTVDNSSGVVTPVP
25-36TYTVDNSSGGGVTPVP
25-37TYTVDSSVVTPVP
25-38TYTVDSSDVPVP
25-39TYTVDSSGGGVTPVP
25-40TYTVDSSGSVTPVP
25-41TYTVDSNDVVTPVP
25-42TYTVNSSNSSSVVTPVP
25-43TYTVNSSVVTPVP
25-44TYTTVDSSSVVTPVP
25-45TYTANSSSVVTPVP
25-46TYTVDSSAVFTPVP
25-47TYTVDSNGVVTPVP
25-48TYTVDSSTPVP
25-49TYTVDSGVVVTPVP
25-50TYTVGSSGVVTPVP
25-51TYVVTPVP
25-52TYTMNSSSVVTPVP
25-53TYTVDSTGVVTPVP
25-54TYSSVVTPVP
25-55TYTVNSSSVVP
25-56TYTVDSSRGVVTPVP
25-57TYTVDSSSVFTPVP
25-58TYTVDSSSSGVVTPVP
25-59TYTVDSSGVVTPVTPVP
25-60TYTVDSSGVATPVP
25-61TYTVDSSG (missing VVTPVP motif)
25-62TDTVDSSGVGTPVP
25-63TYTMGSSGVVTPVP
25-64TYTVDSGVVTSVP
25-65TYTVDSSVVVTPVP
25-66TYTVDSSAGVTPVP
25-67TYTVDSSPVP
25-68TYSSGVVTPVP
25-69TYTTVDSGSVVTPVP
25-70TYTTVDSSSSVVTPVP
25-71TYTTVDSSNVVTPVP
25-72TYTVNSGVVTPVP
25-73SGVVTPVP (missing TYTVD motif)
25-74TYTVGGVVTPVP
25-75TYTVNSSGVVTPVP
25-76TYTVDSKGVVTPVP
25-77TYTVNSSD (missing VTPVP motif)
25-78TYTVDSRVVTPVP
25-79TYTVDSSGVVVTPVP
25-80TYTVDSSSGVFTLTPVP
25-81TYTVDSSDGVTPVP
25-82TYTTVDSSVVTPVP
25-83TYTVDSGGVVTPVP
25-84TYTVDSRSVVTPVP
25-85TYTVNSSSVVT (missing PVP motif)
25-86TYTVDSSVVTLVP
25-87TYTVNIVTPVP
25-88NSSSVVTPVP (missing TYTV motif)
25-89TYSNVVTPVP
25-90TYVDSRGVVTPVP
25-91TYTVDSSGVFTLTPVP
25-92TYTVDSSDDVTPVP
25-93TYTVDSGSVVTPVP
25-94TYTVTVDSSGAVTPVP
25-95TYYTVDSSVVVTPVP
25-96TYTVNSNSSSVGTPVP
P1.26 family
26HFVADSQGKITRVP8807211; 15200858
26-126aHFVADSQGEITRVPAF14608415200858
26-2YFTADPNDQNKITRVP15200858
26-3HFVADSQDKITRVP
26-4DSQGKITRVP (missing HFVA motif)
26-5YFTADSNGQNKITRVP
26-6YFTADPNGQDKITRVP
26-7HFVADSQGQITRVP
26-8HFVENSQGEITRVP
26-9HFVAEGKITRVP
26-10HFVAGSQGKITRVP
P1.28 family
28YYYTTATNSSTSTTFVP8807211; 15200858
28-1YYYTTATNSSTSTTATNSSTSTTFVP
28-2YYYTTATSSSTSTTFVP
28-3YHYTTATNSSTSTTFVP
28-4YYYTTATSSSTSTTATSSSTSTTFVP
28-5YYTTATNSSTTFVP
28-6YYYTTVTNSSTSTTFVP
28-7YYTTATNSSTSTTFVP (missing first Y)
28-8YYTTATNSSTGTTFVP (missing first Y)
28-9YYYTTFVP
P1.30 family
30HYTTVYNATTTTTTFVP15200858
30-130aHYTTVYNATTTTTFVP15200858
30-230bHYTTVYNATTTTTTTFVP10979914; 15200858
30-330cHYTTVYNATTTTTTTTFVP15200858
30-430dHYTTVYNATTTTTTTTTFVP15200858
30-530eHYTTVYNATTTTTTTTTTFVP15200858
30-6HYTTVYNATTTTTTTTTTTFVP
30-7HYTTVYNATTTTTTTTTTTTTFVP
30-8HYTTVYNATTTTFVP
30-9HYTTVYNATTTTTTTTTTTTFVP
30-10HYTTVYNATTTTTTFVS
30-11HYTTVYNATTTFVP
30-12HYTTVYNATTTTTIFVP
30-13YYTTVYNATTTTTTTTFVP
30-14HYTTVYNSNATTTTFVP
30-15HYTTVYNATTTTTTTTTTTTTTFVP
30-16HYTTVYNATTTTTTTIFVP
30-17HYTTTTTTTTTTTTFVP
30-18HYTTVYNATTTTTTIFVP
30-19HYTTVYNATTTITTFVP
30-20HYTTVYNATTTTTAFVP
30-21HYTTVYNATTATTTFVP
30-22HYTTVYNATTTAFVP
30-23HYTTVYNTTTTTFVP
30-24HYTTVYNATTTSVP
30-25HLYNATTTTTTTFVP
30-26YYTTVYNATTTTTTFVP
30-27HYTTVYNATTTTTTAFVP
30-28HYTTVYNTTTTTTTFVP
30-29HYTTVYKATTTTTTTTTFVP
30-30HYTTVYTTTTTTTTTFVP
30-31YYTTVYNATTTTTTTFVP
30-32HYTTTTTTTFVP
30-33HYTTVYNATTTTITFVP
30-34HYTTVYNATTFVP
30-35HYTTVYNATTTTTTTTFVL
30-36HYTTVHNATTTSVP
30-37HYTTTTTTFVP
30-38HYTTTTTTTTFVP
30-39HYTVYNATTTTTTTTFVP
30-40HYNATTTTTTTFVP
30-41HYTTVYNATTTATFVP
30-42HYTTVYNATTTTTTAIFVP
30-43HYTTVYNATTTTFATTTTFVP
30-44HYTTATVYNATTTTFVP
P1.34 family
34YVDDQGKVKG10979914; 15200858
34-1YVDDQKVKG15200858
34-3YVDDRGKVKG
34-4YVDDQGEVKG
34-5YVDDQRKVKG
34-6YLDDQGKVKG
34-7YVDGQGKVKG
P1.42 family
42HLVLDGQGKITQVP
42-1HLVSDGQGKITQVP
42-2DGQGKITQVP (missing HLV[X] motif)
42-3HLVSDGQGEITQVP
42-4HLVSDGQGKITRQGKITQVP
42-5HLVSDSQGKITQVP
42-6HLVLDGQGEITQVP
42-7HFQGKITQVP (missing HLV[X] motif)
42-8HLVSDDQGKITQVP
42-9HLVSDGQDKITQVP
42-10HLVSDGRGKITQVP
42-11HLVSDGQSKITQVP
42-12HLVSDSQSKITQVP
P1.43 family
4335TFTLESNQMKPVP15200858
P1.44 family
44HFVQQLLKVSLLSF
44-1HLFSRLLKVSLLSFR
P1.45 family
45TMENNIVKP

Table generated: Tuesday, 17-Sep-2019 09:02:19 BST

PubMed and Genbank information is provided by the US National Library of Medicine (NLM) and PubMed.  Please see the NCBI Disclaimer and Copyright.