Expand PubMLST Databases Downloads BIGSdb Contact Account

Campylobacter jejuni porA (Product MOMP: Major Outer Membrane Protein)

Gene name: porA.
Designation within complete genome sequence of strain CJ11168: Cj1259.
Location within CJ11168: Start/End 1189121 / 1190395.
Length within CJ11168: 1275bp / 424 aa.
Molecular weight: 45688 Da.

genomic context

Location of the nucleotide sequence fragment used in the database (red) within the complete gene sequence

The PCR amplification primer binding sites are highlighted in blue. This nucleotide sequence (red) from strain 11168 has been assigned allele 34.

ATGAAACTAGTTAAACTTAGTTTAGTTGCAGCTCTTGCTGCAGGTGCTTTTTCAGCAGCT
AACGCTACTCCACTTGAAGAAGCGATCAAAGATGTTGATGTATCAGGTGTATTAAGATAC
AGATACGATACAGGTAATTTTGATAAAAATTTCGTTAACAACTCAAATTTAAACAACAGC
AAACAAGATCACAAATATAGAGCACAAGTTAACTTCAGTGCTGCTATAGCTGATAACTTC
AAAGCTTTTGTTCAATTTGACTATAATGCTGCTGATGGTGGTTATGGTGCTAATGGAATA
AAAAATGATCAAAAAGGACTTTTTGTTCGTCAATTATACTTAACTTATACAAATGAAGAT
GTTGCTACAAGTGTAATCGCTGGTAAACAACAATTAAACCTTATCTGGACGGATAACGCT
ATTGATGGTTTAGTTGGCACAGGTGTTAAAGTAGTAAATAACAGCATCGATGGTTTAACT
CTAGCTGCTTTTGCTGTAGATAGCTTCATGGCTGCAGAGCAAGGTGCAGATTTATTAGAA
CATAGTAATATTTCAACAACATCAAATCAAGCTCCTTTTAAAGTAGATTCAGTAGGAAAT
CTTTACGGTGCTGCTGCTGTAGGTTCTTATGATCTTGCTGGTGGACAATTCAACCCACAA
TTATGGTTAGCTTATTGGGATCAAGTAGCATTCTTCTATGCTGTAGATGCAGCTTATAGT
ACAACTATCTTTGATGGAATCAACTGGACACTTGAAGGTGCTTACTTAGGAAATAGCCTT
GATAGCGAACTTGATGATAAAACACACGCTAATGGCAATTTATTTGCTTTAAAAGGTAGC
ATTGAAGTAAATGGTTGGGATGCTAGCCTTGGTGGTTTATACTACGGTGATAAAGAAAAA
GCTTCTACAGTTGTAATCGAAGATCAAGGTAATCTTGGTTCTTTACTTGCAGGTGAGGAA
ATTTTCTATACTACTGGTTCAAGACTAAATGGTGATACTGGTAGAAATATCTTCGGTTAT
GTAACTGGTGGATATACTTTCAACGAAACAGTTCGCGTTGGTGCTGACTTCGTATATGGT
GGAACAAAAACAGAAGCTGCTAATCATTTAGGTGGTGGTAAAAAACTTGAAGCTGTTGCA
AGAGTAGATTACAAATACTCTCCAAAACTTAACTTCTCAGCATTCTATTCTTATGTGAAC
CTAGATCAAGGTGTAAACACTAATGAAAGTGCTGATCATAGCACTGTAAGACTTCAAGCT
CTTTACAAATTCTAA

Location of the MOMP peptide fragment used in the database (red) within the intact protein

This peptide sequence from strain 11168 has been assigned allele 31

MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVNNSNLNNS
KQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGYGANGIKNDQKGLFVRQLYLTYTNED
VATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMAAEQGADLLE
HSNISTTSNQAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQLWLAYWDQVAFFYAVDAAYS
TTIFDGINWTLEGAYLGNSLDSELDDKTHANGNLFALKGSIEVNGWDASLGGLYYGDKEK
ASTVVIEDQGNLGSLLAGEEIFYTTGSRLNGDTGRNIFGYVTGGYTFNETVRVGADFVYG
GTKTEAANHLGGGKKLEAVARVDYKYSPKLNFSAFYSYVNLDQGVNTNESADHSTVRLQA
LYKF

Trimming sequences to the correct length for database queries

The porA alleles and MOMP peptides contained in this database are different lengths due to insertions and deletions within their sequences (see below). However, they have been trimmed to begin and end within highly conserved regions representing equivalent sequence positions.

Before querying the database, new sequences should be trimmed to the correct length. To identify the trim sites we recommend that the nucleotide sequence is translated and the amino acid sequence aligned as shown below. This assists the identification of the correct trim sites, which are residues DSF at the N-terminus and KKL at the C-terminus, within the yellow boxes.

N and C termini

MOMP peptide sequences aligned from the N-terminal trimming site.

peptide diversity

Occasionally a sequence / peptide motif may be repeated, as shown in the example below.

repeated motif

Links

Citing the database

The preferred format for citing this website in publications is:

This publication made use of the Campylobacter Multi Locus Sequence Typing website (https://pubmlst.org/ campylobacter/) sited at the University of Oxford (Jolley et al. Wellcome Open Res 2018, 3:124 [version 1; referees: 2 approved]). The development of this site has been funded by the Wellcome Trust.