Full information on isolate 11-004
| id | 82 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| isolate | 11-004 | |||||||||||||||||
| other name | B503 | |||||||||||||||||
| strain designation | A: P1.20,9: F3-8: ST-5 (cc5) | |||||||||||||||||
| ST | 5 | |||||||||||||||||
| country | China | |||||||||||||||||
| year | 1984 | |||||||||||||||||
| disease | invasive (unspecified/other) | |||||||||||||||||
| source | CSF | |||||||||||||||||
| epidemiology | epidemic | |||||||||||||||||
| species | Neisseria meningitidis | |||||||||||||||||
| serogroup | A | |||||||||||||||||
| MLEE designation | Subgroup III | |||||||||||||||||
| porB allele | 3-61 | |||||||||||||||||
| porA VR1 | 20 | QPQTANTQQGGKVKVTKA [link to neisseria.org] | ||||||||||||||||
| porA VR2 | 9 | YVDEQSKYHA [link to neisseria.org] | ||||||||||||||||
| porA allele | 19 | |||||||||||||||||
| fetA VR | F3-8 | SQFSIPKTEKKDGKDVDKSLEQQEKDKKDMALVHSYKLS [link to neisseria.org] | ||||||||||||||||
| ET no | 48 | |||||||||||||||||
| Z number | 1503 | |||||||||||||||||
| sender | Mark Achtman | Max-Planck Institut fur Infektionsbiologie, Schumannstr. 21/22, Berlin, Germany | ||||||||||||||||
| curator | Keith Jolley | University of Oxford, UK | keith.jolley@medawar.ox.ac.uk | |||||||||||||||
| date entered | 2001-02-07 | |||||||||||||||||
| datestamp | 2007-01-16 | |||||||||||||||||
| reference | 9501229 | Maiden MC, Bygraves JA, Feil E, Morelli G, Russell JE, Urwin R, Zhang Q, Zhou J, Zurth K, Caugant DA, Feavers IM, Achtman M, Spratt BG (1998) Proc Natl Acad Sci U S A 95:3140-5 Multilocus sequence typing: a portable approach to the identification of clones within populations of pathogenic microorganisms. | 107 isolates | |||||||||||||||
| reference | 12855736 | Thompson EA, Feavers IM, Maiden MC (2003) Microbiology 149:1849-58 Antigenic diversity of meningococcal enterobactin receptor FetA, a vaccine component. | 107 isolates | |||||||||||||||
| reference | 15385499 | Urwin R, Russell JE, Thompson EA, Holmes EC, Feavers IM, Maiden MC (2004) Infect Immun 72:5955-62 Distribution of surface protein variants among hyperinvasive meningococci: implications for vaccine design. | 78 isolates | |||||||||||||||
| reference | 15537808 | Jolley KA, Wilson DJ, Kriz P, McVean G, Maiden MC (2005) Mol Biol Evol 22:562-9 The influence of mutation, recombination, population history, and selection on patterns of genetic diversity in Neisseria meningitidis. | 324 isolates | |||||||||||||||
| reference | 17825091 | Bennett JS, Jolley KA, Sparling PF, Saunders NJ, Hart CA, Feavers IM, Maiden MC (2007) BMC Biol 5:35 Species status of Neisseria gonorrhoeae: evolutionary and epidemiological inferences from multilocus sequence typing. | 576 isolates | |||||||||||||||
| clonal complex | ST-5 complex/subgroup III | |||||||||||||||||
| allelic profile |
| |||||||||||||||||
