Full information on isolate 7891
| id | 7 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| isolate | 7891 | |||||||||||||||||
| other name | B54 | |||||||||||||||||
| strain designation | A: P1.20,9: F3-1: ST-5 (cc5) | |||||||||||||||||
| ST | 5 | |||||||||||||||||
| country | Finland | |||||||||||||||||
| year | 1975 | |||||||||||||||||
| disease | invasive (unspecified/other) | |||||||||||||||||
| source | CSF | |||||||||||||||||
| epidemiology | epidemic | |||||||||||||||||
| species | Neisseria meningitidis | |||||||||||||||||
| serogroup | A | |||||||||||||||||
| MLEE designation | Subgroup III | |||||||||||||||||
| serotype | 4,21 | |||||||||||||||||
| porB allele | 3-27 | |||||||||||||||||
| sero subtype | P1.9 | |||||||||||||||||
| porA VR1 | 20 | QPQTANTQQGGKVKVTKA [link to neisseria.org] | ||||||||||||||||
| porA VR2 | 9 | YVDEQSKYHA [link to neisseria.org] | ||||||||||||||||
| porA allele | 19 | |||||||||||||||||
| fetA VR | F3-1 | GEFSIPTKEKKNGKEVDKPMEQQKKDRADEATVHAYKLS [link to neisseria.org] | ||||||||||||||||
| ET no | 48 | |||||||||||||||||
| Z number | 1054 | |||||||||||||||||
| comments | Pili I,IIa | |||||||||||||||||
| sender | Wendell Zollinger | Dept Bacterial Diseases,Walter Reed Army Institute of Research, Washington DC, USA | ||||||||||||||||
| curator | Keith Jolley | University of Oxford, UK | keith.jolley@medawar.ox.ac.uk | |||||||||||||||
| date entered | 2001-02-07 | |||||||||||||||||
| datestamp | 2007-01-16 | |||||||||||||||||
| reference | 1452360 | Wang JF, Caugant DA, Li X, Hu X, Poolman JT, Crowe BA, Achtman M (1992) Infect Immun 60:5267-82 Clonal and antigenic analysis of serogroup A Neisseria meningitidis with particular reference to epidemiological features of epidemic meningitis in the Peoples Republic of China. | 47 isolates | |||||||||||||||
| reference | 9501229 | Maiden MC, Bygraves JA, Feil E, Morelli G, Russell JE, Urwin R, Zhang Q, Zhou J, Zurth K, Caugant DA, Feavers IM, Achtman M, Spratt BG (1998) Proc Natl Acad Sci U S A 95:3140-5 Multilocus sequence typing: a portable approach to the identification of clones within populations of pathogenic microorganisms. | 107 isolates | |||||||||||||||
| reference | 12855736 | Thompson EA, Feavers IM, Maiden MC (2003) Microbiology 149:1849-58 Antigenic diversity of meningococcal enterobactin receptor FetA, a vaccine component. | 107 isolates | |||||||||||||||
| reference | 15385499 | Urwin R, Russell JE, Thompson EA, Holmes EC, Feavers IM, Maiden MC (2004) Infect Immun 72:5955-62 Distribution of surface protein variants among hyperinvasive meningococci: implications for vaccine design. | 78 isolates | |||||||||||||||
| reference | 15537808 | Jolley KA, Wilson DJ, Kriz P, McVean G, Maiden MC (2005) Mol Biol Evol 22:562-9 The influence of mutation, recombination, population history, and selection on patterns of genetic diversity in Neisseria meningitidis. | 324 isolates | |||||||||||||||
| reference | 17825091 | Bennett JS, Jolley KA, Sparling PF, Saunders NJ, Hart CA, Feavers IM, Maiden MC (2007) BMC Biol 5:35 Species status of Neisseria gonorrhoeae: evolutionary and epidemiological inferences from multilocus sequence typing. | 576 isolates | |||||||||||||||
| clonal complex | ST-5 complex/subgroup III | |||||||||||||||||
| allelic profile |
| |||||||||||||||||
