Full information on isolate 139M

id13
isolate139M
other nameB99
strain designationA: P1.5-2,10: F5-1: ST-1 (cc1)
ST1
countryPhilippines
year1968
epidemiologyendemic
speciesNeisseria meningitidis
serogroupA
MLEE designationSubgroup I
porB allele3-60
porA VR15-2PLPNIQPQVTKR [link to neisseria.org]
porA VR210HFVQNKQNQRPTLVP [link to neisseria.org]
porA allele16
fetA VRF5-1GEFEISGKKKDPKDPKKEIDKTDEEKAKDKKDMDLVHSYKLS [link to neisseria.org]
ET no19
Z number1099
senderWendell ZollingerDept Bacterial Diseases,Walter Reed Army Institute of Research, Washington DC, USA
curatorKeith JolleyUniversity of Oxford, UKkeith.jolley@medawar.ox.ac.uk
date entered2001-02-07
datestamp2007-01-16
reference9501229Maiden MC, Bygraves JA, Feil E, Morelli G, Russell JE, Urwin R, Zhang Q, Zhou J, Zurth K, Caugant DA, Feavers IM, Achtman M, Spratt BG (1998) Proc Natl Acad Sci U S A 95:3140-5
Multilocus sequence typing: a portable approach to the identification of clones within populations of pathogenic microorganisms.
107 isolates
reference12855736Thompson EA, Feavers IM, Maiden MC (2003) Microbiology 149:1849-58
Antigenic diversity of meningococcal enterobactin receptor FetA, a vaccine component.
107 isolates
reference15339342Jolley KA, Sun L, Moxon ER, Maiden MC (2004) BMC Microbiol 4:34
Dam inactivation in Neisseria meningitidis: prevalence among diverse hyperinvasive lineages.
84 isolates
reference15385499Urwin R, Russell JE, Thompson EA, Holmes EC, Feavers IM, Maiden MC (2004) Infect Immun 72:5955-62
Distribution of surface protein variants among hyperinvasive meningococci: implications for vaccine design.
78 isolates
reference15537808Jolley KA, Wilson DJ, Kriz P, McVean G, Maiden MC (2005) Mol Biol Evol 22:562-9
The influence of mutation, recombination, population history, and selection on patterns of genetic diversity in Neisseria meningitidis.
324 isolates
reference17825091Bennett JS, Jolley KA, Sparling PF, Saunders NJ, Hart CA, Feavers IM, Maiden MC (2007) BMC Biol 5:35
Species status of Neisseria gonorrhoeae: evolutionary and epidemiological inferences from multilocus sequence typing.
576 isolates
clonal complexST-1 complex/subgroup I/II
allelic profile
abcZadk aroEfumCgdh pdhCpgm
1 3 1 1 1 1 3